Monday, December 8, 2014

software



Pengertian Software
Nama lain dari Software adalah perangkat lunak. Karena disebut juga sebagai perangkat lunak, maka sifatnya pun berbeda dengan hardware atau perangkat keras, jika perangkat keras adalah komponen yang nyata yang dapat diliat dan disentuh oleh secara langsung manusia, maka software atau Perangkat lunak tidak dapat disentuh dan dilihat secara fisik, software memang tidak tampak secara fisik dan tidak berwujud benda namun  bisa untuk dioperasikan.
Pengertian Software komputer adalah sekumpulan data elektronik yang disimpan dan diatur oleh komputer, data elektronik yang disimpan oleh komputer itu dapat berupa program atau instruksi yang akan menjalankan suatu perintah. Melalui sofware atau perangkat lunak inilah suatu komputer dapat menjalankan suatu perintah

Jenis-jenis Software atau Perangkat Lunak

Software atau perangkat lunak komputer berdasarkan distribusinya dibedakan menjadi beberapa macam, yaitu software berbayar, software gratis atau free ( Freeware, free software, shareware, adware) .

Software berbayar

Software berbayar merupakan perangkat lunak yang didistribusikan untuk tujuan komersil, setiap pengguna yang ingin menggunakan atau mendapatkan software tersebut dengan cara membeli atau membayar pada pihak yang mendistribusikannya. pengguna yang menggunakan software berbayar umumnya tidak diijinkan untuk menyebarluaskansoftware tersebut secara bebas tanpa ijin ada penerbitnya. contoh software berbayar ini misalnya adalah sistem microsoft windows, microsoft office, adobe photo shop, dan lain-lain.

Freeware

Freeware atau perangkat lunak gratis adalah perangkat lunak komputer berhak cipta yang gratis digunakan tanpa batasan waktu, berbeda dari shareware yang mewajibkan penggunanya membayar (misalnya setelah jangka waktu percobaan tertentu atau untuk memperoleh fungsi tambahan). Para pengembang perangkat gratis seringkali membuat perangkat gratis freeware “untuk disumbangkan kepada komunitas”, namun juga tetap ingin mempertahankan hak mereka sebagai pengembang dan memiliki kontrol terhadap pengembangan selanjutnya. Freeware juga didefinisikan sebagai program apapun yang didistribusikan gratis, tanpa biaya tambahan. Sebuah contoh utama adalah suite browser dan mail client dan Mozilla News, juga didistribusikan di bawah GPL (Free Software).

Free Software

Free Software lebih mengarah kepada bebas penggunaan tetapi tidak harus gratis. Pada kenyataannya, namanya adalah karena bebas untuk mencoba perangkat lunak sumber terbuka (Open Source) dan di sanalah letak inti dari kebebasan: program-program di bawah GPL, sekali diperoleh dapat digunakan, disalin, dimodifikasi dan didistribusikan secara bebas. Jadi free software tidak mengarah kepada gratis pembelian tetapi penggunaan dan distribusi. Begitu keluar dari lisensi kita dapat menemukan berbagai cara untuk mendistribusikan perangkat lunak, termasuk freeware, shareware atau Adware. Klasifikasi ini mempengaruhi cara di mana program dipasarkan, dan independen dari lisensi perangkat lunak mana mereka berasal.
Perbedaan yang nyata antara Free Software dan Freeware. Konflik muncul dalam arti kata free dalam bahasa Inggris, yang berarti keduanya bebas dan gratis. Oleh karena itu, dan seperti yang disebutkan sebelumnya, Free Software tidak perlu bebas, sama seperti Freeware tidak harus gratis.

Shareware

Shareware juga bebas tetapi lebih dibatasi untuk waktu tertentu. Shareware adalah program terbatas didistribusikan baik sebagai demonstrasi atau versi evaluasi dengan fitur atau fungsi yang terbatas atau dengan menggunakan batas waktu yang ditetapkan (misalnya 30 hari) . Dengan demikian, memberikan pengguna kesempatan untuk menguji produk sebelum membeli dan kemudian membeli versi lengkap dari program. Sebuah contoh yang sangat jelas dari tipe ini adalah perangkat lunak antivirus, perusahaan-perusahaan ini biasanya memudahkan pelepasan produk evaluasi yang hanya berlaku untuk jumlah hari tertentu. Setelah melewati maksimum, program akan berhenti bekerja dan Anda perlu membeli produk jika Anda ingin tetap menggunakannya.
Kita juga dapat menemukan perangkat lunak bebas sepenuhnya, namun termasuk dalam program periklanan, distribusi jenis ini disebut Adware. Sebuah contoh yang jelas adalah program Messenger dari Microsoft yang memungkinkan penggunaan perangkat lunak bebas dalam pertukaran untuk masuk dengan cara iklan banner atau pop-up.
Itulah artikel penjelasan mengenai pengertian software atau perangkat lunak komputer. Semoga ulasan di atas dapat menambah pengetahuan dan wawasan kamu di bidang komputer.

Continue reading software

Sunday, December 7, 2014

CARA CEPAT MEMBENTUK OTOT DADA KEKAR PRIA



CARA CEPAT MEMBENTUK OTOT DADA KEKAR PRIA

Membesarkan otot dada disini kami akan memberikan beberapa Cara Membentuk Otot Dada SixPack dan Atletis. hmmm, memang otot six pack
adalah dambaan setiap pria. Agar seperti diatas anda harus mengatur pola makan, banyak olahraga dan beristirahat cukup.
Ok berikut Cara Membentuk Otot Dada dengan Cepat yang dapat anda peroleh dengan Pola teratur.
1. Pola Makan yang disiplin, artinya makan 5-6x sehari, tinggi protein, rendah karbohidrat dan rendah lemak. Tujuannya untuk meningkatkan metabolisme tubuh dan menajamkan massa otot kita.

2. Pola Latihan yang rutin, artinya menu latihan dalam seminggu rata untuk semua bagian otot kita. Contohnya kita ingin membentuk otot perut tapi tetap perlu Memperhatikan latihan kaki. Selain itu, usahakan selalu mendahulukan otot besar (dada, punggung, bahu, kaki) baru otot kecil (lengan, perut dan betis) saat melatih dalam 1 sesi.

3. Pola Istirahat yang cukup, artinya kita merusak otot dalam sesi latihan dan istirahat memperbaiki otot kita menjadi
lebih besar dan kuat. Sehingga kualitas dan kuantitas istirahat yang tinggi akan sangat membantu kita mencapai tujuan.

4. Pola Suplemen yang jitu, artinya kita mesti jeli memilih jenis suplemen yang akan membantu program kita. Berikut ini saya sampaikan bentuk latihan yang sering di pakai Cara Membentuk Otot Pria .

Planks: latihan ini sederhana sekali. Anda cukup membuat posisi seperti push up, tetapi saat tangan lurus tegak. Kemudian anda tahan selama mungkin tubuh anda tetap urus, saat itu otot perut dan punggung anda akan bekerja keras untuk menahannya tetap lurus.

Reverse crunch: latihan ini seperti crunch/sit up biasa, tetapi bedanya bukan badan yang diangkat, melainkan kaki yang bergerak dari tertekuk
menjadi lurus. Otot perut bagian bawah anda akan terlatih dari ini.

Captain chair: latihan ini menggunakan alat dimana siku dan tangan kita sebagai penompang tubuh dan kemudian mengangkat kaki hingga 90 derajat.
Jika anda sudah terbiasa, bisa menggunakan dumbbell yang dijepitkan dikaki untuk
menambahkan beban.

Butt ups: latihan ini seperti Planks, tapi tidak statis,
setelah posisi Planks lalu tarik panggul ke atas.
Kemudian kembali ke posisi semula dan ulangi lagi.

Barbell abs rollout: gunakan alat rollout khusus untuk ini yang
berupa roda tunggal dengan pegangan di dua sisinya. Tetapi jika tidak ada bisa menggunakan barbell yang bagian platnya bebas berputar. Bertumpu pada lutut dan kedua lengan berpegang pada rollout. Dorong rollout ke depan hingga punggung sejajar dengan lantai (bukan menempel) lalu tarik kembali.
Continue reading CARA CEPAT MEMBENTUK OTOT DADA KEKAR PRIA

Tuesday, November 25, 2014

cara mengganti kursor sesuai dengan keinginan kita


Oke langsug saja,, hehe
- Masuk Ke Blogger - Pilih Template - Edit HTML
- Dan Cari Code </head>
- Pilih kursor sesuai keinginanmu dibawah ini dan Paste code-nya tepart diatas code </head>
Cursor 1
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/horse-ani1.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 2
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/Heart.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
 Cursor 3
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/Halloween_2.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 4
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/Fly_2.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 5
 <style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/aliendance.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 6
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/apple-tmani.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 7
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/bounce.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 8
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/tail2.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 9
<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/bluemultiglit.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a> 
Cursor 10

<style type="text/css">body, a:hover {cursor: url(http://justnaira-css-js.googlecode.com/svn/mouse/Arrow_02.gif), progress;}</style><a href="http://www.justnaira.com" target="_blank" title="Blogger Widgets"><img src="https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjnPBbirYCIYRA91NErrH7kEiJAPN1U5OndHPv9pBeVozEOaK7vkoCPc7v19WaCJgwq094-nAVPCeQEuxEYzu12EFBwSYrxHCOlvTgAozDGa7ZUX8EWgcgT4wqg2yTTv766He1RAfk16A/s1600/www.justnaira.com.png" border="0" alt="Blogger Widgets" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 11
<style type="text/css">body, a:hover {cursor: url(http://cur.cursors-4u.net/cursors/cur-11/cur1058.ani), url(http://cur.cursors-4u.net/cursors/cur-11/cur1058.png), progress;}</style><a href="http://www.cursors-4u.com/cursor/2012/03/03/blue-fire-pointer.html" target="_blank" title="Blue Fire Pointer"><img src="http://cur.cursors-4u.net/cursor.png" border="0" alt="Blue Fire Pointer" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 12

<style type="text/css">body, a:hover {cursor: url(http://cur.cursors-4u.net/cursors/cur-10/cur949.ani), url(http://cur.cursors-4u.net/cursors/cur-10/cur949.png), progress;}</style><a href="http://www.cursors-4u.com/cursor/2011/12/26/batman-begins-help-select.html" target="_blank" title="Batman Begins - Help Select"><img src="http://cur.cursors-4u.net/cursor.png" border="0" alt="Batman Begins - Help Select" style="position:absolute; top: 0px; right: 0px;" /></a>
Cursor 13
<style type="text/css">body, a:hover {cursor: url(http://cur.cursors-4u.net/cursors/cur-3/cur201.ani), url(http://cur.cursors-4u.net/cursors/cur-3/cur201.png), progress;}</style><a href="http://www.cursors-4u.com/cursor/2009/04/22/shiny-flashy-green-matrix.html" target="_blank" title="Shiny Flashy Green Matrix"><img src="http://cur.cursors-4u.net/cursor.png" border="0" alt="Shiny Flashy Green Matrix" style="position:absolute; top: 0px; right: 0px;" /></a>
Continue reading cara mengganti kursor sesuai dengan keinginan kita

cara merawat lcd laptop



LCD Laptop adalah salah satu komponen laptop yang cukup mahal harganya apabila terjadi penggantian akibat rusak. Rusaknya LCD laptop ini memang disebabkan oleh banyak faktor, bisa karena faktor bawaan dari pabrik ataupun faktor manusia yang menggunakannya yaitu di perlakuan dan cara merawat LCD laptop itu sendiri.
Permasalahan yang sering dihadapi oleh pengguna laptop antara lain adalah LCD dengan tampilan bergaris, tampilan bergetar , warna kurang tajam, dan missing color. Permasalahan ini banyak dialami oleh LCD yang masih menggunakan inverter atau neon sebagai backlightnya. dan sebagian besar kerusakan LCD susah ditangani kecuali dengan penggantian.
Berdasarkan pengalaman, kerusakan LCD laptop disebakan oleh VGA module nya kurang baik secara kualitasnya. VGA module tersusun oleh VGA chipset, kabel flexibel, konektor flexibel ke LCD, konektor flexibel ke mainboard, dan inverter. Ini adalah kerusakan LCD laptop yang disebabkan oleh faktor bawaan dari pabrik pembuatannya.
Faktor lain penyebab kerusakan LCD laptop adalah karena penggunaan dan cara merawat LCD laptop yang kurang benar. Laptop tidak sama dengan PC desktop yang lebih kuat dan tahan apabila kita nyalakan seharian. Semakin lama laptop dinyalakan akan menyebabkan panas yang berlebihan di dalam laptop itu sendiri walaupun sudah ada fasilitas pendinginan di dalam laptop. Hal ini disebabkan oleh ruang kosong yang lebih sempit jika dibandingkan dengan PC desktop biasa. Panas pada laptop inilah yang menyebabkan kerusakan pada laptop, yang salah satunya adalah LCD laptop yang rusak.
Bagaimana cara merawat LCD laptop agar awet dan tahan lama?
  • Bersihkan LCD laptop secara berkala dengan menggunakan cairan khusus pembersih LCD laptop.
  • Jangan menggunakan laptop lebih dari 3 jam berturut-turut, matikan sekitar 10 menit, kemudian anda bisa menghidupkan kembali laptop anda.
  • Untuk penggunaan dalam waktu lama gunakan coolingpad yang berkualitas yaitu coolingpad yang menggunakan adaptor sendiri, bukan yang mengambil dari USB laptop.
  • Gunakan contras dan brightness sedang pada pengaturan LCD laptop.
  • Atur LCD time off ketika laptop tidak digunakan di menu power option windows.
  • Membuka dan menutup LCD laptop dengan benar yaitu  dengan memegangnya dari kedua sisi kanan kirinya, bukan dari atasnya, karena di bagian atas ada blok yg rentan rusak.
Demikian cara merawat LCD laptop agar awet dan tahan lama.
Semoga bermanfaat dan selalu kunjungi blog.fastncheap.com.

Continue reading cara merawat lcd laptop

Saturday, November 22, 2014

,

20 FaktaMengerikanMengenaiMasaDepan Kita danBumi



20 FaktaMengerikanMengenaiMasaDepan Kita danBumi*

Bumikitainitidakakanbertahanselamanya, sedangkankitabergantungpadabumiuntukbertahanhidup. Kita akanbinasasemuanyaapabilabumihancurolehberbagaisebab. Kedengarannyamenakutkansekali, tetapikitaperlumenyadaribahwasumberdayabumiterbatas.Penggunaansumberdayabumisecaraserampangansepertisekarangini, bisamenyebabkankehidupanmanusiaberakhirdalamkehancuran.

save the earth 20 FaktaMengerikanMengenaiMasaDepan Kita danBumi

Para ilmuwanberspekulasimengenaiperubahan-perubahankomposisibumi, apakahitutentangpemanasan global atausumberdaya mineral yang sudahmulaimerosot. Marilahkitamengamatibagaimanakitasecaraperlahannamunpastimenujukepadakehancuran yang dibuatolehtangankitasendiri.

Jadibagaimanakahmasadepankitadanbumi yang kitadiamiini? Berikutinifakta-faktanya:

1. Pemanasan global adalahsatuperistiwa yang takbisadielakkan yang mempengaruhikondisiiklim di bumi. Badai yang menghancurkan, gelombang air pasang, tsunami dankelaparanakibatkekeringanakanterusberlanjutmeskipunusaha-usahauntukmengendalikanpolusidankerusakanlingkungantelahdilakukan. Bumiberusahauntukteruseksisdenganmelakukanperbaikanalami, tetapikitamanusiaakanmenerimaakibatnyadikarenakan proses perbaikanitusangatdahsyatdantidakterkendali.

2. Peningkatankecilrotasibumidiakibatkanketidakseimbanganisikandunganperutbumi yang terkuras, bisamempengaruhikitadenganberbagaicara. Banjirdahsyat yang menenggelamkansegalanya, ataugletser-gletser yang menghilangselamanya.Itubisaberartikekurangan air, pangandanmerajalelanyapenyakitsertameluasnyakelaparan.Beberapaspesieshewandantanamanmenjadipunah.

3. Terjadinyaperubahanpolaperuntukantanah, di manasekaranglebihbanyak orang-orang hidup di kota-kotabesardibandingdengan di daerahpedesaan. Kota-kotapenuhsesaksehinggaharusmemperluas areal untukperumahankewilayahpedesaandenganmengorbankantanahpertanian.Kota besar yang kumuhdankotormengganggukesehatanmanusiadanmenimbulkanbibit-bibitpenyakitbaru.

4. Produksiminyakmengalamipeningkatantahun 2008 dan 2018 akanmencapaipuncaknya, danituberartiawaldaripenurunan. Inibisamenjadipencetussuaturesesienergi global, konflikantarnegara yang memperebutkanlahanminyakdanjugasumbermakanan.Minyaksangatpentingbagisetiapbangsauntukmelanjutkanaktivitasproduksinya, termasukpertaniandanpeternakan.Kedepannya, menipisnyakandunganminyak di bumibisamempengaruhihidupseluruhmanusia di bumisecarasignifikan.

5. Mobil mempunyaiandilsebesar 3/4 darisemua gas buang yang dipancarkanalattransportasi. Sejaksaatini, duniaakandipenuhilebihdarisatumilyarmobil yang berkeliaran di jalan-jalan di tahun 2030 danakanbertambahhinggasatumilyarlagi di tahun 2050. Hal berhubungandengan75% peningkatan CO2 selamasetahun di atmosferberasaldaripembakaranbahanbakarfosil (minyakbumi, gas bumidanbatubara), sedangkansekitar 20% CO2 yang memasukiatmosferbumiberasaldaripembakaran BBM padamesin-mesinkendaraanbermotor, selebihnya 80% emisi CO2 bersumberdaripembakaranbahanbakarfosilolehmesinpembangkittenagalistrik.

6. Karenapeningkatansuhuudaraakibatmeningkanyakadar CO2, makasedikituap air bertahan di udarauntukmembentukawan. Hal iniberartihujanakanmenjadilebihsedikit, dansecaralangsungberakibathasilproduksipertanianjugamenurun. Akan terjadi di sekitartahun 2020 di manaterjadisuatuperiode yang sulitdan air bahtiba-tibameningkat di semuabagiandaribenuaEropa, karenamencairnyaes di Kutub Utara.Sedangkanpopulasipendudukbumiakanmencapai 7,7milyar orang.

7. SejakHariBumi yang pertamatahun 1970 hinggaawal millennium baru, manusiatelahmembuatpeningkatanemisi (gas buang) rumahkacasebesar 70%.

8. Atmosferbumisekarangmengandung 40% lebihbanyak CO2 dibandingkandengan di awalRevolusiIndustri.

9. Hasilpembakaranbahanbakarfosildewasainimenambahhampir 6 milyar ton CO2 kedalamatmosferbumisetiaptahunnya. Hanyaseparuhnya yang diserapolehhutan-hutandansamudera.

10. Hutanhujanpernahmeliputi 14% daripermukaanbumi. Sekaranghanyatersisasekitar 6% danmenurutperkiraanparaahlihutanhujan yang tersisaituakanhabisdikonsumsikurangdari 40 tahun. 1 sampai 1,5hektarhutanhujanlenyapsetiap 1 detiksebagaikonsekuensitragispembangunan di negara-negaraindustridanberkembang.

11.Hampirseparuhdarisemuajenis flora, fauna danmikroorganismeakanmusnahataupastiterancamkepunahandalamseperempatabadkedepandisebabkanolehpenebanganhutan-hutanhujan.

12. Perkiraanparaahlibahwakitasedangkehilangan 137 jenistanaman, hewandanseranggasetiapharinyakarenapenebanganhutan-hutanhujan. Atausamadengan 50.000 jenissetiaptahunnya. Seiringdenganlenyapnyaspesies-spesies di hutanhujan, demikianjugadenganberbagaimacampengobatanpenyakit-penyakit yang mengancamhidupmanusia.Sekarangini, 121 obat-obatan yang dijualkeseluruhduniaberasaldaritanamanobat-obatan.Sementaraitu 25% dariperusahaanobat-obatan di Barat mengambilbahandariramuantanamandarihutanhujan, danlebihsedikit 1% daripohon-pohondantanaman-tanamantropisinitelahdiujicobaolehparailmuwan.

13. Penebanganhutan yang merajalelasekaranginimenyumbang 20% polusipemanasan global diakibatkanolehterhambatnyapenyerapankembali CO2.

14. Wabahpenyakitterusbertambahbaikragammaupunjumlahnyakarenapolusiudara, air dantanahmeningkat, terutamasekaliterjadi di negara-negaradenganpendapatanrendah.

15. Di tahun 2030 sekitar 18% darigugusankaranglautakanlenyapkarenaperubahaniklimdanlingkungan. Dalam 2030 inipopulasipendudukduniaakanmencapai 8,3milyar.

16. Tahun 2040 laut di Kutub Utara akanmengalamimusimpanas yang pertamatanpaes.

17. Karenamenghilangnyagletserdanterjadimusimkering yang panjang, produksilistrikdaripembangkitlistriktenaga air akanberkurang.

18. Luaspadangpasir di permukaanbumimengalamipeningkatandisebabkanmenaiknyasuhubumi. Padaakhirtahun 2007, Australia kehilangan 25% produksipangannyakarenahalini.

19. Kadar karbonmonoksida (CO) di atmosferbumiterusmeningkat.

20. Efekberbahayadariaktivitasmanusiadapatmempengaruhisistem global dengancara yang negatif. Perang, sebagaicontoh, dapatmenghancurkanbumidalamberbagaijalan; pembunuhanmassal, berkembangnyakelaparandanpenyakit, pembakaranbahanbakarfosilsecarabesar-besaranolehmesin-mesinperang, termasukjugapembabatanhutandanpengambilanbatu-batuandantanahuntukperbaikankembaliinfrastruktur yang rusak.

Sebuahpertanyaanuntukkitasemua; apakahupayakitauntukikutmembantukelestarianalamsekaranginibisamemberidampak yang berartidansignifikan, ataukahsecaraironiaktivitaskitalainnyamalahmempercepatkerusakandankehancuranbumi !
JAGALAH BUMI UNTUK KITA SEMUA :-)


Continue reading 20 FaktaMengerikanMengenaiMasaDepan Kita danBumi